MYL10_MOUSE Q62082
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62082
Recommended name：Myosin regulatory light chain 10
EC number：
Alternative names：(Myosin light chain 2, lymphocyte-specific) (Precursor lymphocyte-specific regulatory light chain)
Cleaved into：
GeneID：59310
Gene names (primary )：Myl10
Gene names (synonym )：Mylc2pl Plrlc
Gene names (ORF )：
Length：202
Mass：22511
Sequence：MGQSSLDHGVQGPVAGTGDFGPLKEATATGFISCAQAPRRARKRVEGTASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Tissue specificity：Specifically expressed in precursor B- and T-lymphocytes. {ECO:0000269|PubMed:1628631}.
Induction：Up-regulated by interleukin-7. {ECO:0000269|PubMed:1628631}.
Developmental stage：
Protein families：