MMGT2_MOUSE Q8R3L0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R3L0
Recommended name：Membrane magnesium transporter 2
EC number：
Alternative names：
Cleaved into：
GeneID：216829
Gene names (primary )：Mmgt2
Gene names (synonym )：
Gene names (ORF )：
Length：123
Mass：13922
Sequence：MVAWLWKVLMGVGLFALTHAAFSAAQHRSHARLTEKKYEPLPADIVLQTLLAFALTCYGVVHTAGDFRDRDATSELKDMTFDTLRNRPSFYVFHRSGYRLFQRPDSTHSSNLSASSSDLPLKF
Tissue specificity：High expression levels in brain and kidney with lower levels in heart, colon and liver. Very low levels in intestine. In kidney, highest levels in distal convoluted tubule. {ECO:0000269|PubMed:18057121}.
Induction：Up-regulated by low extracellular Mg(2+). {ECO:0000269|PubMed:18057121}.
Developmental stage：
Protein families：Membrane magnesium transporter (TC 1.A.67) family