NIPA1_MOUSE Q8BHK1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BHK1
Recommended name：Magnesium transporter NIPA1
EC number：
Alternative names：(Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homolog)
Cleaved into：
GeneID：233280
Gene names (primary )：Nipa1
Gene names (synonym )：Spg6
Gene names (ORF )：
Length：323
Mass：34105
Sequence：MGTAAAAAAAGEGARGPSPAAVSLGLGVAVVSSLVNGSTFVLQKKGIVRAKRRGTSYLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGALGVPFGSILASYLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTTVSVGIVLIQVFKEFNFNLGEMNKSNMKTD
Tissue specificity：Widely expressed. Predominantly expressed in neuronal tissues. Brain, heart, kidney, liver and colon (at protein level). {ECO:0000269|PubMed:14508708, ECO:0000269|PubMed:17166836}.
Induction：Up-regulated by low magnesium ion levels. {ECO:0000269|PubMed:17166836}.
Developmental stage：
Protein families：NIPA family