NIPA4_MOUSE Q8BZF2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BZF2
Recommended name：Magnesium transporter NIPA4
EC number：
Alternative names：(Ichthyin) (NIPA-like protein 4) (Non-imprinted in Prader-Willi/Angelman syndrome region protein 4 homolog)
Cleaved into：
GeneID：214112
Gene names (primary )：Nipal4
Gene names (synonym )：Ichn Nipa4
Gene names (ORF )：
Length：406
Mass：44059
Sequence：MELRVANANGSCENGSIVSLYCSSQEVLCQIVRGISPEEPYNATLITWQERVRKKYGFYIGVGLAFLSCFLIGTSVILKKKGLIRLVATGATRAVNGGYGYLKDPMWWAGMATMSAGEVANFGAYAFAPATVVTPLGALSVLISAIFSSYCLGESLNLLGKLGCVICMAGSTVMVIHAPKEEKVTTVAEMASKMKDTGFIVFAVLLVVSCLILIFIVAPRYGQRNILIYIIICSVIGSFSVTAVKGLGVTIRNFFQGLPVVRHPLPYILSLILGLSIIIQVNFLNRALDIFNTSLVFPIYYVFFTTVVVASSIVLFKEWYTMSAVDIVGTLSGFVTIILGVFMLHAFKDLDINQISLPHTHKNPTPAPAPEPTVIKLEDKNVLVDNIELASTPSPQQKPKVFMTDS
Tissue specificity：
Induction：Up-regulated by low magnesium ion levels. {ECO:0000269|PubMed:18667602}.
Developmental stage：
Protein families：NIPA family