TP8L1_MOUSE Q8K288
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K288
Recommended name：Tumor necrosis factor alpha-induced protein 8-like protein 1
EC number：
Alternative names：(TIPE1) (TNF alpha-induced protein 8-like protein 1) (TNFAIP8-like protein 1) (Oxidative stress regulated gene-beta) (Oxy-beta)
Cleaved into：
GeneID：66443
Gene names (primary )：Tnfaip8l1
Gene names (synonym )：
Gene names (ORF )：
Length：186
Mass：20818
Sequence：MDTFSTKSLALQAQKKVLSKMASKAMVAVFVDNTSSEVLDELYQATKEFTRSRKEAQRVVKNLVKVAVKLAVLLRADQLDSNELAQLQRFRGRVRSLAMTALSFHQVDFTFDRRVLATGLLECRDLLHQAIGPHLTAKSHGRINHIFSHFANGDFLAALYSPAEPYRSHLCRICDGLGRMLDEGGI
Tissue specificity：Detected in wide variety tissues, such as neurons in brain, hepatocytes, germ cells of female and male reproductive organs, muscular tissues and variety types of cells of the epithelial origin (at protein level). {ECO:0000269|PubMed:21600655}.
Induction：Up-regulated by oxidative stress and by 6-hydroxydopamine (6-OHDA) in dopaminergic neurons. {ECO:0000269|PubMed:19878437, ECO:0000269|PubMed:24444419}.
Developmental stage：
Protein families：TNFAIP8 family