PLS1_MOUSE Q9JJ00
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJ00
Recommended name：Phospholipid scramblase 1
EC number：EC 3.1.-.-
Alternative names：(PL scramblase 1) (Ca(2+)-dependent phospholipid scramblase 1) (Mg(2+)-dependent nuclease) (Transplantability-associated protein 1) (NOR1) (TRA1)
Cleaved into：
GeneID：22038
Gene names (primary )：Plscr1
Gene names (synonym )：Tra1b Tras1
Gene names (ORF )：
Length：328
Mass：35914
Sequence：MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAGYQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNCPPGLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ
Tissue specificity：Highly expressed in kidney, lung, liver and bone marrow, slightly in spleen, heart and macrophage.
Induction：Up-regulated by SCF/KITL and GCSF/CSF3. {ECO:0000269|PubMed:12010804}.
Developmental stage：
Protein families：Phospholipid scramblase family