CST11_MOUSE   Q9D269


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D269

Recommended name:Cystatin-11

EC number:

Alternative names:(Cystatin-E1) (Cystatin-related epididymal spermatogenic protein 2)

Cleaved into:

GeneID:78240

Gene names  (primary ):Cst11

Gene names  (synonym ):Cres2 CSTE1

Gene names  (ORF ):

Length:139

Mass:16217

Sequence:MAAGSWKATRLLLAILVALVAFSYQVKRKTFIRIEEVSALESSVKETLEYVTDEYNKKSEDLYNFRILRILKIMKQVTGHLEYHITVEMQRTTCLKTETSLCDIQKGELHKKIQCYFSVYAIPWVEVFKILKKNCTDIS

Tissue specificity:Expressed in epididymis, where it localizes to the proximal caput and also part of the midcaput. Not detected in other tissues tested. {ECO:0000269|PubMed:12586767, ECO:0000269|PubMed:12700194}.

Induction:Up-regulated by testicular factors. However, does not seem to be directly regulated by androgens or estrogen. {ECO:0000269|PubMed:12586767, ECO:0000269|PubMed:12700194}.

Developmental stage:

Protein families:Cystatin family


   💬 WhatsApp