PSB7_MOUSE   P70195


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70195

Recommended name:Proteasome subunit beta type-7

EC number:EC 3.4.25.1

Alternative names:(Macropain chain Z) (Multicatalytic endopeptidase complex chain Z) (Proteasome subunit Z)

Cleaved into:

GeneID:19177

Gene names  (primary ):Psmb7

Gene names  (synonym ):Mmc14

Gene names  (ORF ):

Length:277

Mass:29891

Sequence:MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS

Tissue specificity:

Induction:Up-regulated by the antioxidant dithiolethione (D3T) in colon (at protein level). {ECO:0000269|PubMed:17521679}.

Developmental stage:

Protein families:Peptidase T1B family


   💬 WhatsApp