F210B_MOUSE Q9D8B6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D8B6
Recommended name：Protein FAM210B, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：67017
Gene names (primary )：Fam210b
Gene names (synonym )：
Gene names (ORF )：
Length：190
Mass：20344
Sequence：MAGLLTLLGPAGRVSTRLRPLAPWLLGTATSCAPPLWALALSHPVPDARLLRTARGDCLSRQEPNRTPEPGGSVTGTEKKLSRTQQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVVSSGIDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPFVVRYFRSVGLFKPPATKP
Tissue specificity：Expressed in late erythroblast differentiation stages (PubMed:26968549). {ECO:0000269|PubMed:26968549}.
Induction：Up-regulated by the erythroid transcription factor GATA1 (PubMed:26968549). {ECO:0000269|PubMed:26968549}.
Developmental stage：
Protein families：FAM210 family