IF27B_MOUSE Q8VC49
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VC49
Recommended name：Interferon alpha-inducible protein 27-like protein 2B
EC number：
Alternative names：(Interferon-stimulated gene 12 protein B2) (ISG12(b2))
Cleaved into：
GeneID：217845
Gene names (primary )：Ifi27l2b
Gene names (synonym )：Isg12(b2)
Gene names (ORF )：
Length：283
Mass：27772
Sequence：MKRKFVGAAIGGALAVAGAPVALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGVLGLSTITNIILVAVGTATGARAEGSMGASREQESGPQDPPQELQEPQEPPSCKKQDLNLGKFVGAAIGGALAVAGAPIALSAVGFTGAGIAAGSIAAKMMSAAAIANGGGIAAGGLVATLQSVGILGLSTSTNIILGAVGAATGATAAGAMGACREQEPGLQDLQQEPKEPQEPQELQKQQEPQEPQELQKQQETQETQETQELQKTQEPPSYEK
Tissue specificity：
Induction：Up-regulated by type-I interferon (PubMed:21151029). Up-regulated by poly(I:C) (PubMed:21151029). {ECO:0000269|PubMed:21151029}.
Developmental stage：
Protein families：IFI6/IFI27 family