C1QT4_MOUSE   Q8R066


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R066

Recommended name:Complement C1q tumor necrosis factor-related protein 4

EC number:

Alternative names:(C1q/TNF-related protein 4)

Cleaved into:

GeneID:67445

Gene names  (primary ):C1qtnf4

Gene names  (synonym ):Ctrp4

Gene names  (ORF ):

Length:326

Mass:35058

Sequence:MLLLLLGFLGPAACWALGPAGPGSSELRSAFSAARTTPLEGTSEMAVTFDKVYVNIGGDFDAATGRFRCRVPGAYFFSFTAGKAPHKSLSVMLVRNRDEVQALAFDEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLVYADADADAPARGPAAPEPRSAFSAARTRSLVGSDAAPGPRHRPLAFDTELVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLPLRRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAAAGPPALKPPEL

Tissue specificity:High expression in testis, kidney, and brain. Expressed in brain and kidney (at protein level). Within the brain, highly expressed in cerebellum, cortex, hippocampus and hippothalamus, and lower expression in hindbrain (at protein level). Serum levels were increased in leptin-deficient ob/ob mice (a genetic model of hyperphagia and morbid obesity) relative to age-matched lean controls. No difference in serum levels were detected between mice fed a low-fat versus high-fat diet for 14 weeks (PubMed:24366864). {ECO:0000269|PubMed:24366864}.

Induction:Up-regulated during acute colitis induced by injection of dextran sulfate sodium (DSS). {ECO:0000269|PubMed:27086950}.

Developmental stage:

Protein families:


   💬 WhatsApp