TTP_MOUSE P22893
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22893
Recommended name:mRNA decay activator protein ZFP36
EC number:
Alternative names:(Growth factor-inducible nuclear protein NUP475) (TPA-induced sequence 11) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)
Cleaved into:
GeneID:22695
Gene names (primary ):Zfp36
Gene names (synonym ):Nup475 Tis11 Tis11a Ttp
Gene names (ORF ):
Length:319
Mass:33613
Sequence:MDLSAIYESLQSMSHDLSSDHGGTESLGGLWNINSDSIPSGVTSRLTGRSTSLVEGRSCGWVPPPPGFAPLAPRPGPELSPSPTSPTATPTTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPTEDLALPGQPHVLRQSISFSGLPSGRRSSPPPPGFSGPSLSSCSFSPSSSPPPPGDLPLSPSAFSAAPGTPVTRRDPNQACCPSCRRSTTPSTIWGPLGGLARSPSAHSLGSDPDDYASSGSSLGGSDSPVFEAGVFGPPQTPAPPRRLPIFNRISVSE
Tissue specificity:Expressed in skeletal muscle satellite cells (PubMed:25815583). Strongly expressed in differentiated adipocytes compared to preadipocytes (at protein level) (PubMed:22701344). Expressed in embryonic stem cells (ESCs) (PubMed:24733888). Expressed in heart, placenta, kidney, intestine, liver, lung, thymus, fat and spleen (PubMed:2204625, PubMed:1699942). {ECO:0000269|PubMed:1699942, ECO:0000269|PubMed:2204625, ECO:0000269|PubMed:22701344, ECO:0000269|PubMed:24733888, ECO:0000269|PubMed:25815583}.
Induction:Up-regulated during adipocyte differentiation (PubMed:17288565, PubMed:22701344). Up-regulated transiently in response to fibroblast growth factor FGF4 in a MAPK-dependent manner in embryonic stem cells (ESCs) (PubMed:24733888). Up-regulated by interferons and/or lipopolysaccharide (LPS) in a STAT1- and p38 MAPK-dependent manner (PubMed:11533235, PubMed:16514065, PubMed:16508014, PubMed:16508015). Down-regulated in muscle satellite cells upon muscle injury (at protein level) (PubMed:25815583). Up-regulated by various mitogens (PubMed:7559666). Up-regulated by LPS and TNF-alpha (PubMed:9703499). Up-regulated by interferon IFN-gamma and/or LPS in a STAT1- and p38 MAPK-dependent manner (PubMed:15187092, PubMed:16514065). Up-regulated during adipocyte differentiation (PubMed:22701344). Up-regulated in keratinocytes during epidermal repair after wound healing (PubMed:20166898). Down-regulated during the conversion from quiescence to activated satellite cells upon muscle injury (PubMed:23046558, PubMed:25815583). {ECO:0000269|PubMed:11533235, ECO:0000269|PubMed:15187092, ECO:0000269|PubMed:16508014, ECO:0000269|PubMed:16508015, ECO:0000269|PubMed:16514065, ECO:0000269|PubMed:17288565, ECO:0000269|PubMed:20166898, ECO:0000269|PubMed:22701344, ECO:0000269|PubMed:23046558, ECO:0000269|PubMed:24733888, ECO:0000269|PubMed:25815583, ECO:0000269|PubMed:7559666, ECO:0000269|PubMed:9703499}.
Developmental stage:
Protein families: