FCOR_MOUSE P0DJI6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DJI6
Recommended name：Foxo1-corepressor
EC number：EC 2.3.1.-
Alternative names：(FCoR) (Foxo1 CoRepressor)
Cleaved into：
GeneID：
Gene names (primary )：Fcor
Gene names (synonym )：
Gene names (ORF )：
Length：106
Mass：11233
Sequence：MGGPTRRHQEEGSAECLGGPSTRAAPGPGLRDFHFTTAGPSKADRLGDAAQIHRERMRPVQCGDGSGERVFLQSPGSIGTLYIRLDLNSQRSTCCCLLNAGTKGMC
Tissue specificity：Expressed in adipocytes. Expressed in brown and white adipose tissue but not in liver. Protein levels in brown and white adipose tissues decrease following fasting (at protein level). Expressed in white and brown adipose tissues. Expressed in adipocytes. Not expressed in liver, skeletal muscle and brain. {ECO:0000269|PubMed:22510882}.
Induction：Up-regulated during adipocyte differentiation. Up-regulated by starved state in white (WAT) and brown (BAT) adipose tissues. Down-regulated during fasting in WAT and BAT. Up-regulated during cold exposure in BAT. {ECO:0000269|PubMed:22510882}.
Developmental stage：
Protein families：