CF410_MOUSE   Q8C6G1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C6G1

Recommended name:Cilia- and flagella-associated protein 410

EC number:

Alternative names:

Cleaved into:

GeneID:67884

Gene names  (primary ):Cfap410

Gene names  (synonym ):

Gene names  (ORF ):

Length:249

Mass:28239

Sequence:MKLTRKMVLSRAKASELHNVRKLNCWGSQLTDISICREMPSLEVITLSVNSVSTLEPVRSCRRLSELYLRRNRIPSLNELFYLKDLPHLRVLWLAENPCCGTSPHLYRMTVLRNLPHLQKLDNQAVTEEELTRALMEGDEITAAPHREGAGNGCPKPPYALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRDTMRSHKNRNILTAILLLLRELDTEGLETVQQTVGSRLQALHRPEPQEDME

Tissue specificity:Expressed in the retina. {ECO:0000269|PubMed:26167768, ECO:0000269|PubMed:26294103}.

Induction:Up-regulated during cartilage differentiation (PubMed:26974433).

Developmental stage:

Protein families:


   💬 WhatsApp