CK2N1_MOUSE Q6QWF9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6QWF9
Recommended name：Calcium/calmodulin-dependent protein kinase II inhibitor 1
EC number：
Alternative names：(calcium/calmodulin-dependent protein kinase II inhibitor alpha) (mCaMKIINalpha)
Cleaved into：
GeneID：66259
Gene names (primary )：Camk2n1
Gene names (synonym )：
Gene names (ORF )：
Length：78
Mass：8513
Sequence：MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV
Tissue specificity：Brain specific (at protein level). {ECO:0000269|PubMed:17350603}.
Induction：Up-regulated during consolidation of fear memory. Down-regulated in brain during Japanese encephalitis virus (JEV) and rabies virus infection. {ECO:0000269|PubMed:16819996, ECO:0000269|PubMed:17010311}.
Developmental stage：
Protein families：CAMK2N family