PLPP7_MOUSE Q91WB2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WB2
Recommended name：Inactive phospholipid phosphatase 7
EC number：
Alternative names：(Nuclear envelope transmembrane protein 39) (Phosphatidic acid phosphatase type 2 domain-containing protein 3)
Cleaved into：
GeneID：227721
Gene names (primary )：Plpp7
Gene names (synonym )：Net39 Ppapdc3
Gene names (ORF )：
Length：271
Mass：29710
Sequence：MPASQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERRQSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLDYLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDVISGFIIGYFQFRLVELVWMSSNTCQMLISAW
Tissue specificity：Highly expressed in heart and muscle. {ECO:0000269|PubMed:17062158, ECO:0000269|PubMed:19704009}.
Induction：Up-regulated during myoblast differentiation. {ECO:0000269|PubMed:17062158, ECO:0000269|PubMed:19704009}.
Developmental stage：
Protein families：PA-phosphatase related phosphoesterase family