BRI3_MOUSE   P28662


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P28662

Recommended name:Brain protein I3

EC number:

Alternative names:

Cleaved into:

GeneID:55950

Gene names  (primary ):Bri3

Gene names  (synonym ):

Gene names  (ORF ):

Length:125

Mass:13643

Sequence:MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAVFT

Tissue specificity:High expression in cerebral cortex, and in cerebellar cortex.

Induction:Up-regulated during TNF-mediated inflammation and immunity. {ECO:0000269|Ref.4}.

Developmental stage:

Protein families:BRI3 family


   💬 WhatsApp