HYAL3_MOUSE Q8VEI3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VEI3
Recommended name：Hyaluronidase-3
EC number：EC 3.2.1.35
Alternative names：(Hyal-3) (Hyaluronoglucosaminidase-3)
Cleaved into：
GeneID：109685
Gene names (primary )：Hyal3
Gene names (synonym )：Hyl3
Gene names (ORF )：
Length：412
Mass：46132
Sequence：MIMHLGLMMVVGLTLCLMHGQALLQVPEHPFSVVWNVPSARCKAHFGVHLPLDALGIVANHGQHFHGQNISIFYKNQFGLYPYFGPRGTAHNGGIPQAVSLDHHLARAAHQILHSLGSSFAGLAVLDWEEWYPLWAGNWGPHRQVYLAASWVWTQQMFPGLDPQEQLHKAHTSFEQAARALMEYTLQLGRTLRPSGLWGFYRYPACGNGWHKMASNYTGHCHAAITTRNTQLRWLWAASSALFPSIYLPPRLPLAYRQAFVRHRLEEAFRVALLEHSHPLPVLAYSRLTHRSSGRFLSLDDLMQTIGVSAALGTAGVVLWGDLSFSSSEEKCWRLHDYLVGTLGPYVINVTKAAMACSHQRCHGHGRCARKDPGQMEAFLHLQPDDSLGAWNSFRCHCYSGWAGPTCLEPKP
Tissue specificity：Expressed in testis, epididymal tissue, epididymal luminal fluid (ELF), acrosome-intact (AI) sperm and caput (CAP), corpus (COR) and caudal (CAU) sperm. Higher expression in sperm than testis (at protein level) (PubMed:20586096). Liver, kidney, skin, brain, stomach and testis (PubMed:11929860). Expressed mainly in granulosa cells of the ovaries. Expressed in small and large antral follicles. Not present in theca or stroma cells (PubMed:18653706). Expressed in testis and liver (PubMed:18762256). Expressed in testis and CAP, COR, and CAU epididymis tissue (PubMed:20586096). {ECO:0000269|PubMed:11929860, ECO:0000269|PubMed:18653706, ECO:0000269|PubMed:18762256, ECO:0000269|PubMed:20586096}.
Induction：Up-regulated expression in apoptotic granulosa cells and in atretic follicles of the ovaries (PubMed:18653706). {ECO:0000269|PubMed:18653706}.
Developmental stage：
Protein families：Glycosyl hydrolase 56 family