AKIR1_MOUSE Q99LF1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99LF1
Recommended name：Akirin-1
EC number：
Alternative names：(Mighty protein)
Cleaved into：
GeneID：68050
Gene names (primary )：Akirin1
Gene names (synonym )：Mighty
Gene names (ORF )：MNCb-2831
Length：191
Mass：21676
Sequence：MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPLQMQTPPASLQQPAPPGSERRLPTPEQIFQNIKQEYNRYQRWRHLEVVLSQSEACTSETQPSSSALTAPGSPGAFWMKKDQPTFTLRQVGIICERLLKDYEDKVREEYEQILSTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS
Tissue specificity：Expressed in macrophages and satellite cells. {ECO:0000269|PubMed:18255059, ECO:0000269|PubMed:19406121}.
Induction：Up-regulated in activated satellite cells and in the regenerating muscle (PubMed:19406121). Down-regulated by MSTN in skeletal muscle (PubMed:19406121, PubMed:18255059, PubMed:23516508). Down-regulated by dexamethasone by a MSTN (PubMed:23516508). {ECO:0000269|PubMed:18255059, ECO:0000269|PubMed:19406121, ECO:0000269|PubMed:23516508}.
Developmental stage：
Protein families：Akirin family