CO8A1_MOUSE Q00780
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q00780
Recommended name：Collagen alpha-1(VIII) chain
EC number：
Alternative names：
Cleaved into：Vastatin
GeneID：12837
Gene names (primary )：Col8a1
Gene names (synonym )：
Gene names (ORF )：
Length：744
Mass：73607
Sequence：MAVPPRPLQLLGILFIISLNSVRLIQAGAYYGIKPLPPQIPPQIPPQIPQYQPLGQQVPHMPLGKDGLSMGKEMPHMQYGKEYPHLPQYMKEIPPVPRMGKEVVPKKGKGEVPLASLRGEQGPRGEPGPRGPPGPPGLPGHGMPGIKGKPGPQGYPGIGKPGMPGMPGKPGAMGMPGAKGEIGPKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGAKGERGPKGPPGPPGLQGPKGEKGFGMPGLPGLKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGPPGEPGPQGLIGVPGVQGPPGMPGVGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGVGKPGFPGPKGDRGIGGVPGVLGPRGEKGPIGAPGMGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGVVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEGGHKGLPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIVGPSGPIGPPGIPGPKGEPGLPGPPGFPGVGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPTPSPQGEYLPDMGLGIDGVKPPHAYAGKKGKHGGPAYEMPAFTAELTVPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPMMYTYDEYKKGFLDQASGSAVLLLRPGDQVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
Tissue specificity：High levels in calvarium, eye and skin of newborn mice; also in various epithelial, endothelial and mesenchymal cells. {ECO:0000269|PubMed:15063777, ECO:0000269|PubMed:19401424}.
Induction：Up-regulated in astrocytes during the repair process and in mesangial cells in diabetic animals. {ECO:0000269|PubMed:15063777, ECO:0000269|PubMed:19401424}.
Developmental stage：
Protein families：