AN34B_MOUSE Q3UUF8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UUF8
Recommended name:Ankyrin repeat domain-containing protein 34B
EC number:
Alternative names:(Dendritic cell progenitor protein of 58 kDa)
Cleaved into:
GeneID:218440
Gene names (primary ):Ankrd34b
Gene names (synonym ):Dp58
Gene names (ORF ):
Length:508
Mass:55417
Sequence:MDEGSEVSTDGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDQQSVGRAKMVKYLLENSADPNIQDKSGKSALMHACLERAGPEVVSLLLKSGADLSLQDHSGYSALVYAINAEDRDTLKVLLSACQAKGKEVIIITTAKSPSGRHTTQHHLNMPPADMDGSHPPATPSEIDIKTASLPLSYSSETDLTLFGFKDKELCGGSDNTWDPDSPPRKPVIATNGPKLSQAPAWIKSTPSLKHQARVASLQEELQDITPEEEIAYKTNALALSKRFITRHQSIDVKDTAHLLRAFDQVNSRKMSYDEINYHSLFPEGSQTSVEIPTDRDPDSNQIFASTLKSIVQKRNSGANHYSSDSQLAEGVTPPTVEDGKAAKKKIFAPSPSLLSGSKELVEPAPPGPLSRRNHAVLERRGSGAFPLDHSLAQSRPGFLPPLNVNPHPPITDIGVNNKICGLLSCGQKALMPTAPIFPKEFKTKKMLLRRQSLQTEQIKQLVNF
Tissue specificity:Specifically and constitutively expressed in brain (at protein level). {ECO:0000269|PubMed:17485271}.
Induction:Up-regulated in bone marrow upon differentiation (at protein level). {ECO:0000269|PubMed:15358210, ECO:0000269|PubMed:17485271}.
Developmental stage:
Protein families:ANKRD34 family