CP4F3_MOUSE Q99N16
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N16
Recommended name：Cytochrome P450 4F3
EC number：
Alternative names：(CYPIVF3) (Leukotriene-B(4) omega-1/omega-2 hydroxylase)
Cleaved into：
GeneID：72054
Gene names (primary )：Cyp4f3
Gene names (synonym )：Cyp4f18
Gene names (ORF )：
Length：524
Mass：59843
Sequence：MSQLSMSWMGLGHTAASPWLLLLLAGASCLLAYILTPIYGVFENSLRLRCFPQPPKRNWILGHLGLIQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKPVVLAPALVAPKDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFNDSTNIMHAKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSTLVARRHQRLLLHVDLFYYLTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFIDVLLLSKDEHGKALSDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPDGRVIPKGVISRISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLKVEPLSAGAQ
Tissue specificity：Highest level in polymorphonuclear leukocytes and dendritic cells. Detectable in lymph nodes, spleen, bone marrow and peripheral blood. Highly expressed in ovary. Very low level in liver, kidney, and smooth muscle. Expressed in neutrophils (at protein level). {ECO:0000269|PubMed:16380383, ECO:0000269|PubMed:24632148}.
Induction：Up-regulated in bone marrow-derived dendritic cells by bacterial lipopolysaccharide (LPS), a ligand for toll-like receptor 4 (TLR4), and by poly(I:C), a ligand for TLR3. {ECO:0000269|PubMed:16380383}.
Developmental stage：
Protein families：Cytochrome P450 family