INSI2_MOUSE   Q91WG1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WG1

Recommended name:Insulin-induced gene 2 protein

EC number:

Alternative names:(INSIG-2)

Cleaved into:

GeneID:72999

Gene names  (primary ):Insig2

Gene names  (synonym ):

Gene names  (ORF ):

Length:225

Mass:24915

Sequence:MAEGETESPRPKKCGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNFQFSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

Tissue specificity:Expressed in liver, testis, kidney, spleen, intestine, brain and adrenal gland. {ECO:0000269|PubMed:12624180}.

Induction:Up-regulated in differentiating preadipocytes. {ECO:0000269|PubMed:12869692}.

Developmental stage:

Protein families:INSIG family


   💬 WhatsApp