PAQR7_MOUSE Q80ZE4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZE4
Recommended name:Membrane progestin receptor alpha
EC number:
Alternative names:(mPR alpha) (Membrane progesterone P4 receptor alpha) (Membrane progesterone receptor alpha) (PPAR-gamma-induced liver protein) (Progesterone and adipoQ receptor family member 7) (Progestin and adipoQ receptor family member 7) (Progestin and adipoQ receptor family member VII)
Cleaved into:
GeneID:71904
Gene names (primary ):Paqr7
Gene names (synonym ):Mpra Pglp
Gene names (ORF ):
Length:345
Mass:39306
Sequence:MAMAVAQKFNHLLSSLWHVGQKPPQPEPVFTVDRAQVPPLFWKPYIYAGYRPLHQNWCFYFRTLFQRHNEAVNVWTHLLAALALLLRLIGLAASVDFREDPHALPLFFIVLASFTYLSFSAVAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHDKVQAIFLPTAAFLAWLSCAGSCYNKYSQKPGLLGRIFQEAPSALAYVLDISPVLHRIIVSPLPAEEDPALLYHKCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARRGIYEPLHARWPHNFSGLFLLTVASSSLTALLLSQLVRRKLHQKTK
Tissue specificity:Detected in most adult tissues. Higher expression found in white fat and liver than brown fat and skeletal muscle. {ECO:0000269|PubMed:15589683}.
Induction:Up-regulated in PPAR gamma 1-induced adipogenic liver. {ECO:0000269|PubMed:15589683}.
Developmental stage:
Protein families:ADIPOR family