DERL2_MOUSE   Q8BNI4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BNI4

Recommended name:Derlin-2

EC number:

Alternative names:(Degradation in endoplasmic reticulum protein 2) (Der1-like protein 2) (F-LANa)

Cleaved into:

GeneID:116891

Gene names  (primary ):Derl2

Gene names  (synonym ):Der2 Flana

Gene names  (ORF ):

Length:239

Mass:27640

Sequence:MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDIFPNQPGGIRILKTPSILRTIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG

Tissue specificity:Widely expressed, with lowest levels in brain and heart. {ECO:0000269|PubMed:11500051, ECO:0000269|PubMed:16186509}.

Induction:Up-regulated in response to endoplasmic reticulum stress via the ERN1-XBP1 pathway of the unfolded protein response (UPR). {ECO:0000269|PubMed:16186509, ECO:0000269|PubMed:16449189}.

Developmental stage:

Protein families:Derlin family


   💬 WhatsApp