CAVN3_MOUSE Q91VJ2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91VJ2
Recommended name:Caveolae-associated protein 3
EC number:
Alternative names:(Cavin-3) (Protein kinase C delta-binding protein) (Serum deprivation response factor-related gene product that binds to C-kinase)
Cleaved into:
GeneID:109042
Gene names (primary ):Cavin3
Gene names (synonym ):Prkcdbp Srbc
Gene names (ORF ):
Length:260
Mass:27853
Sequence:MGESALEPGPVPETPAGGPVHAVTVVTLLEKLATMLEALRERQGGLAERQGGLAGSVRRIQSGLGALSRSHDTTSNTLTQLLAKAERVGSHADAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEETEIPARAFQKVPELLGPEDQLVLGPDQPEDEVGESSEEEPVESRAQRLRRTGLQKVQSLKRALSSRKAAQPTPVKPPRVGPVRSSEGPSEGQPAAQPEMESELETALEPEPPQPTKEDPEKPVLQIESAA
Tissue specificity:Lung, heart, skeletal muscle, liver, brain, vascular and urinary bladder smooth muscle (at protein level). Strongly expressed in uterus, ovary, mammary and epithelial cells. Also expressed in spleen, intestine, kidney and testis. {ECO:0000269|PubMed:19546242, ECO:0000269|PubMed:23652019, ECO:0000269|PubMed:28285351, ECO:0000269|PubMed:9054438}.
Induction:Up-regulated in serum-starvated cells or during cell growth arrest. {ECO:0000269|PubMed:9054438}.
Developmental stage:
Protein families:CAVIN family