LYPD3_MOUSE   Q91YK8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91YK8

Recommended name:Ly6/PLAUR domain-containing protein 3

EC number:

Alternative names:(GPI-anchored metastasis-associated protein C4.4A homolog)

Cleaved into:

GeneID:72434

Gene names  (primary ):Lypd3

Gene names  (synonym ):C4.4a

Gene names  (ORF ):

Length:363

Mass:37489

Sequence:MDAARRGDTQPVMWTTGWLLLLPLLLCEGAQALECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPHEMDLEVIQEEGASLSGGAAGHGGTAGHGGAAGHQDRSNMEKYPGKGGAQIPAKGGSGTLGSWLSAVLLTVVAGAML

Tissue specificity:

Induction:Up-regulated in suprabasal keratinocytes of hyperplastic skin induced by phorbol-ester. {ECO:0000269|PubMed:15012588}.

Developmental stage:

Protein families:


   💬 WhatsApp