LIME1_MOUSE   Q9EQR5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQR5

Recommended name:Lck-interacting transmembrane adapter 1

EC number:

Alternative names:(Lck-interacting molecule)

Cleaved into:

GeneID:72699

Gene names  (primary ):Lime1

Gene names  (synonym ):Lime

Gene names  (ORF ):

Length:269

Mass:29551

Sequence:MRPPVPSAPLALWVLGCFSLLLWLWALCTACHRKRAQRQQTGLQDSLVPVEMPLLRQTHLCSLSKSDTRLHELHRGPRSSIAPRPASMDLLHPRWLEMSRGSTRSQVPNSAFPPRQLPRAPPAAPATAPSTSSEATYSNVGLAAIPRASLAASPVVWAGTQLTISCARLGPGAEYACIQKHKGTEQGCQELQQKAKVIPATQMDVLYSRVCKPKRRDPRPVTDQLNLQDGRTSLPLGSDVEYEAINLRGQDMKQGPLENVYESIKEMGL

Tissue specificity:Expressed in spleen and lung. Present in primary B-cells and peripheral T-cells (at protein level). {ECO:0000269|PubMed:14610044, ECO:0000269|PubMed:16249387}.

Induction:Up-regulated in T-cells following TCR engagement. {ECO:0000269|PubMed:14610044}.

Developmental stage:

Protein families:


   💬 WhatsApp