F107A_MOUSE Q78TU8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q78TU8
Recommended name：Actin-associated protein FAM107A
EC number：
Alternative names：
Cleaved into：
GeneID：268709
Gene names (primary )：Fam107a
Gene names (synonym )：
Gene names (ORF )：
Length：144
Mass：17510
Sequence：MYSEIQRERADIEGLMARPEYREWNSELIKPKKLLNPVKASRSHQELHRELLMNHKRGLGMDSKPELQRVLEHRRRNQLIKKKEEELEAKRMQCPFKQELLRRQQRLNQLENPPQRDEDHAPEFIKVRENLRRITTLTSEERAL
Tissue specificity：Expressed in septum, the neocortex, the CA3 region of the hippocampus and the cerebellum (at protein level). {ECO:0000269|PubMed:21969592}.
Induction：Up-regulated in the hypothalamic paraventricular nucleus (PVN) and the CA3 region of the hippocampus of the brain in response to postnatal maternal separation or food deprivation and glucocorticoids stimulation in adult animals (PubMed:21969592). Up-regulated in CA1, CA3 and dente gyrus regions of the hippocampus in response to acute social defeat stress or glucocorticoids stimulation (PubMed:25637808). {ECO:0000269|PubMed:21969592, ECO:0000269|PubMed:25637808}.
Developmental stage：
Protein families：