REG3B_MOUSE P35230
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35230
Recommended name：Regenerating islet-derived protein 3-beta
EC number：
Alternative names：(REG-3-beta) (Pancreatitis-associated protein 1) (Regenerating islet-derived protein III-beta) (Reg III-beta)
Cleaved into：Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa form
GeneID：18489
Gene names (primary )：Reg3b
Gene names (synonym )：Pap Pap1
Gene names (ORF )：
Length：175
Mass：19476
Sequence：MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
Tissue specificity：Constitutively expressed in the small intestine, moderately in colon and at an extremely low level in healthy pancreas.
Induction：Up-regulated in the intestine by S.typhimurium infection (at protein level). Appears in pancreatic juice after induction of pancreatic inflammation. {ECO:0000269|PubMed:21694778}.
Developmental stage：
Protein families：