LERL1_MOUSE Q9CQ74
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ74
Recommended name:Leptin receptor overlapping transcript-like 1
EC number:
Alternative names:(Endospanin-2)
Cleaved into:
GeneID:68192
Gene names (primary ):Leprotl1
Gene names (synonym ):
Gene names (ORF ):
Length:131
Mass:14414
Sequence:MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW
Tissue specificity:
Induction:Up-regulated in the liver of fasting animals. {ECO:0000269|PubMed:19907080}.
Developmental stage:
Protein families:OB-RGRP/VPS55 family