LERL1_MOUSE   Q9CQ74


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ74

Recommended name:Leptin receptor overlapping transcript-like 1

EC number:

Alternative names:(Endospanin-2)

Cleaved into:

GeneID:68192

Gene names  (primary ):Leprotl1

Gene names  (synonym ):

Gene names  (ORF ):

Length:131

Mass:14414

Sequence:MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW

Tissue specificity:

Induction:Up-regulated in the liver of fasting animals. {ECO:0000269|PubMed:19907080}.

Developmental stage:

Protein families:OB-RGRP/VPS55 family


   💬 WhatsApp