IL23A_MOUSE Q9EQ14
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQ14
Recommended name：Interleukin-23 subunit alpha
EC number：
Alternative names：(IL-23 subunit alpha) (IL-23-A) (Interleukin-23 subunit p19) (IL-23p19)
Cleaved into：
GeneID：83430
Gene names (primary )：Il23a
Gene names (synonym )：
Gene names (ORF )：
Length：196
Mass：22071
Sequence：MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Tissue specificity：Secreted by activated dendritic cells (at protein level). Detected in various tissues with higher expression in polarized Th1 cells and activated macrophages. {ECO:0000269|PubMed:11114383}.
Induction：Up-regulated in trigeminal glanglia after herpes simplex virus type 1 infection, in the lung of mice infected with mycobacteria or Klebsiella pneumoniae. Up-regulated in microglia by combined LPS and IFNG stimulation. Up-regulated by FASLG. {ECO:0000269|PubMed:11801672, ECO:0000269|PubMed:12162874, ECO:0000269|PubMed:14568135, ECO:0000269|PubMed:16339539}.
Developmental stage：
Protein families：IL-6 superfamily