PGP_MOUSE   Q8CHP8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CHP8

Recommended name:Glycerol-3-phosphate phosphatase

EC number:EC 3.1.3.21

Alternative names:(G3PP) (Aspartate-based ubiquitous Mg(2+)-dependent phosphatase) (AUM) (Phosphoglycolate phosphatase) (PGP)

Cleaved into:

GeneID:67078

Gene names  (primary ):Pgp

Gene names  (synonym ):

Gene names  (ORF ):

Length:321

Mass:34541

Sequence:MAEAEAGGDEARCVRLSAERAKLLLAEVDTLLFDCDGVLWRGETAVPGAPETLRALRARGKRLGFITNNSSKTRTAYAEKLRRLGFGGPVGPEAGLEVFGTAYCSALYLRQRLAGVPDPKAYVLGSPALAAELEAVGVTSVGVGPDVLHGDGPSDWLAVPLEPDVRAVVVGFDPHFSYMKLTKAVRYLQQPDCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGSTCSLKTILTLTGVSSLEDVKSNQESDCMFKKKMVPDFYVDSIADLLPALQG

Tissue specificity:Ubiquitously expressed with higher expression in testis, heart, skeletal muscle and islet tissue (at protein level). {ECO:0000269|PubMed:24338473, ECO:0000269|PubMed:26755581}.

Induction:Up-regulated in white adipose tissue and down-regulated in brown adipose tissue upon fasting. {ECO:0000269|PubMed:26755581}.

Developmental stage:

Protein families:HAD-like hydrolase superfamily, CbbY/CbbZ/Gph/YieH family


   💬 WhatsApp