INSI1_MOUSE Q8BGI3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGI3
Recommended name：Insulin-induced gene 1 protein
EC number：
Alternative names：(INSIG-1)
Cleaved into：
GeneID：231070
Gene names (primary )：Insig1
Gene names (synonym )：
Gene names (ORF )：
Length：259
Mass：28213
Sequence：MPRLHDHVWNYPSAGAARPYSLPRGMIAAAACPQGPGVPEPEHAPRGQRAGTTGCSARPGSWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
Tissue specificity：
Induction：Up-regulated progressively in the fat tissue as they develop diet-induced obesity (PubMed:12869692). Up-regulated in differentiating preadipocytes (PubMed:12869692). {ECO:0000269|PubMed:12869692}.
Developmental stage：
Protein families：INSIG family