NEUFC_MOUSE Q5SSH8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5SSH8
Recommended name：Neuferricin
EC number：
Alternative names：(Cytochrome b5 domain-containing protein 2)
Cleaved into：
GeneID：192986
Gene names (primary )：Cyb5d2
Gene names (synonym )：
Gene names (ORF )：
Length：263
Mass：29162
Sequence：MLRICGLGVVLSLAVAAVAVMAVWLMDWWGPRPGIRLFLPEELARYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGAHYSGFAGRDASRAFVTGDYSEAGLVDDINGLSSSEILTLHNWLSFYEKNYVFVGRLVGRFYRKDGLPTSELTQVEAMVTKGMEANEQEQREKQKFPPCNSEWSSAKGSRLWCSQKSGGVHRDWIGVPRKLYKPGAKEPHCVCVRTTGPPSDQQDNPRHSNHGDLDNPNLEEYTGCPPLATTCSFPL
Tissue specificity：Expressed in various tissues including brain, heart, adrenal gland, and kidney. In the brain, mainly expressed in pyramidal cells around the CA3 region of Ammon horn in hippocampus. Present in brain (at protein level). {ECO:0000269|PubMed:19968755}.
Induction：
Developmental stage：Abundantly expressed in the developing brain, in subventricular and ventricular zones of the cerebrum, where neural stem cells and neural precursor cells primarily exist. Expression levels gradually increase during brain development, between 14.5 dpc and P49. {ECO:0000269|PubMed:19968755}.
Protein families：Cytochrome b5 family, MAPR subfamily