DFAR1_MOUSE P17533
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17533
Recommended name：Alpha-defensin-related sequence 1
EC number：
Alternative names：(CRS1C) (Cryptdin-related protein 1C) (Defensin-related cryptdin-related sequence 1)
Cleaved into：
GeneID：
Gene names (primary )：Defa-rs1
Gene names (synonym )：Defcr-rs1
Gene names (ORF )：
Length：116
Mass：12941
Sequence：MKTLVLLSALVLPCFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC
Tissue specificity：Small bowel.
Induction：
Developmental stage：Accumulates to high levels in intestinal crypt epithelium during postnatal development.
Protein families：Alpha-defensin family