SCF_MOUSE   P20826


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P20826

Recommended name:Kit ligand

EC number:

Alternative names:(Hematopoietic growth factor KL) (Mast cell growth factor) (MGF) (Steel factor) (Stem cell factor) (SCF) (c-Kit ligand)

Cleaved into:Soluble KIT ligand (sKITLG)

GeneID:17311

Gene names  (primary ):Kitlg

Gene names  (synonym ):Kitl Mgf Sl Slf

Gene names  (ORF ):

Length:273

Mass:30645

Sequence:MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Tissue specificity:Expressed in the cochlea. {ECO:0000269|PubMed:26522471}.

Induction:

Developmental stage:Acts in the early stages of hematopoiesis.

Protein families:SCF family


   💬 WhatsApp