SPRN_MOUSE Q8BWU1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BWU1
Recommended name：Shadow of prion protein
EC number：
Alternative names：(Protein shadoo)
Cleaved into：
GeneID：212518
Gene names (primary )：Sprn
Gene names (synonym )：Gm169
Gene names (ORF )：
Length：147
Mass：14591
Sequence：MNWTAATCWALLLAAAFLCDSCSAKGGRGGARGSARGVRGGARGASRVRVRPAPRYGSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSGSGSVHSPRICLLLGGTLGALELLRP
Tissue specificity：Mainly expressed in brain (at protein level). In brain, it is highly expressed in the hippocampus and cerebellum and is also expressed at lower level in other areas of the brain including the cerebral cortex, the thalamus and the medulla. In hippocampus and cerebellum it is highly expressed in the cell bodies of pyramidal cells and Purkinje cells, respectively. {ECO:0000269|PubMed:17703189}.
Induction：Strongly down-regulated in prion-infected brains (at protein level). {ECO:0000269|PubMed:17703189}.
Developmental stage：Appears at embryonic day 16 and persists in early postnatal life and in the brains of adults (at protein level). {ECO:0000269|PubMed:17703189}.
Protein families：SPRN family