STP1_MOUSE   P10856


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10856

Recommended name:Spermatid nuclear transition protein 1

EC number:

Alternative names:(STP-1) (TP-1)

Cleaved into:

GeneID:21958

Gene names  (primary ):Tnp1

Gene names  (synonym ):

Gene names  (ORF ):

Length:55

Mass:6407

Sequence:MSTSRKLKTHGMRRGKNRAPHKGVKRGGSKRKYRKSVLKSRKRGDDASRNYRSHL

Tissue specificity:Testis-specific. {ECO:0000269|PubMed:3382664}.

Induction:

Developmental stage:Appears in elongating/condensing spermatids when histones are still detectable (PubMed:15163613). Coexpressed with H2ab1 during late spermiogenesis (PubMed:28366643). {ECO:0000269|PubMed:15163613, ECO:0000269|PubMed:28366643}.

Protein families:Nuclear transition protein 1 family


   💬 WhatsApp