DDX59_MOUSE Q9DBN9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBN9
Recommended name:Probable ATP-dependent RNA helicase DDX59
EC number:EC 3.6.4.13
Alternative names:(DEAD box protein 59) (Zinc finger HIT domain-containing protein 5)
Cleaved into:
GeneID:67997
Gene names (primary ):Ddx59
Gene names (synonym ):Znhit5
Gene names (ORF ):
Length:619
Mass:68234
Sequence:MFVPRSLKIKRSSNDDLKSGEAKKSKPEAGGLQVEGDRDTPVHTSVTEEAVTADKPGHASSTNSPSCQLAEVSSTGPDEGVKDSHPSEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVKEGEGSLRPSSPQRVAAEPESPLDAFYVYKEHPFIVTLKEDQIETLKQQLGISVQGQDVARPIIDFEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIRAFSEDKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLYRLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVVDEADTMLKMGFQQQVLDVLEHTPGDCQTILVSATIPDSIEQLTDQLLHNPVRIITGDKNLPCASVRQIILWVEDPAKKKKLFEILNDQKLFKPPVLVFVDCKLGADLLSEAVQKITGLNSTSIHSEKSQVERRDILKGLLEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRVGRLGQNGTAITFINNNSKRLFWDVAKRVKPTGSILPPQLLNSPYLHEQKRKEQQKDRQTQNSLVTGANLMDIIRKHEKSSSQK
Tissue specificity:
Induction:
Developmental stage:AT 11.5 dpc, expressed in the developing snout region, eye and limb buds. At 13.5 dpc, highly enriched in the lips, palatal shelves (secondary palate), and developing limb buds. {ECO:0000269|PubMed:23972372}.
Protein families:DEAD box helicase family, DDX59 subfamily