C99L2_MOUSE Q8BIF0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BIF0
Recommended name：CD99 antigen-like protein 2
EC number：
Alternative names：(MIC2-like protein 1) (CD antigen CD99)
Cleaved into：
GeneID：171486
Gene names (primary )：Cd99l2
Gene names (synonym )：Mic2l1
Gene names (ORF )：
Length：237
Mass：25463
Sequence：MVARLTAFLVCLVFSLATLVQRGYGDTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVTYSKQETQSAEPPPPEPPRI
Tissue specificity：Highly expressed in the nervous system, including brain, dentate nucleus of hippocampus, granular and Purkinje cells of cerebellum, brain stem nucleus and choroid plexus. Expressed in peripheral blood T- and B-cells and neutrophils (at protein level). Almost undetectable in bone marrow-derived neutrophils (at protein level). Also expressed in thymocytes (at protein level) with higher expression in cortical thymocytes than in medullary thymocytes. Expressed at high levels in testis (mostly in germ cells and Sertoli cells) and ovary (mostly in granulosa cells). Expressed in lung, heart, kidney and liver (at protein level); however, expression in heart, kidney and liver seems restricted to endothelial cells (at protein level). Highly expressed in endothelial cells and to a lower level in vascular smooth muscle cells (at protein level). Low expression in spleen. {ECO:0000269|PubMed:12706889, ECO:0000269|PubMed:17344467, ECO:0000269|PubMed:18163232}.
Induction：
Developmental stage：At 12.5 dpc, expressed in most tissues, especially in the nervous system, including the cerebral cortex, cerebellum, spinal cord and ganglion. There is no change in expression pattern from 12.5 dpc to neonatal day 1. Highly expressed in the subventricular zone and cortical plate of fetal brain and in the dorsal root ganglion of the peripheral nervous system. Except in the nervous system, expression in adult tissues is weaker than in fetal ones.
Protein families：CD99 family