VWC2_MOUSE Q8C8N3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C8N3
Recommended name：Brorin
EC number：
Alternative names：(Brain-specific chordin-like protein) (CR (chordin-like cysteine-rich) domain-containing adhesive protein) (Cradin) (von Willebrand factor C domain-containing protein 2)
Cleaved into：
GeneID：319922
Gene names (primary )：Vwc2
Gene names (synonym )：
Gene names (ORF )：
Length：324
Mass：35383
Sequence：MPSSSAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDSPGRVSELGRASRDEGSSARDWKSKGSRALSGREAWSKQKQAWAAQGGSAKAADWQVRPRGDTPQGEPPAAAQEAISLELVPTPELPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDNSQCCPQCKEKKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM
Tissue specificity：Predominantly expressed in the brain (at protein level). It is expressed in the neurons but not the glial cells. {ECO:0000269|PubMed:17400546, ECO:0000269|PubMed:18757743, ECO:0000269|PubMed:22632720}.
Induction：
Developmental stage：At 12.5 dpc, predominantly expressed in the developing diencephalon. At 16.5 dpc and 18.5 dpc, expressed in the brain, spinal cord, developing neural tubes and tongue but not in the cerebral cortex. At 16.5 dpc, present in developing oral and tooth germ epithelia (at protein level). {ECO:0000269|PubMed:17400546, ECO:0000269|PubMed:18757743}.
Protein families：