PDLI7_MOUSE Q3TJD7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TJD7
Recommended name：PDZ and LIM domain protein 7
EC number：
Alternative names：(LIM mineralization protein) (LMP) (Protein enigma)
Cleaved into：
GeneID：67399
Gene names (primary )：Pdlim7
Gene names (synonym )：Enigma
Gene names (ORF )：
Length：457
Mass：50119
Sequence：MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLNIDGENAGSLTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKALTPPADPPRYTFAPSASLNKTARPFGAPPPTDSTLRQNGQLLRQPVPDASKQRLMEDTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEFMKKSSQVPRTEAPAPASTIPQESWPGPTTPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQNRTSIVQAAAGGGTGGGSNNGKTPVCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPNCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLCKSHAFSHV
Tissue specificity：
Induction：
Developmental stage：At 13.5 dpc expressed in epaxial, intercostal, and other skeletal muscles at the brachial level, including the latissimus dorsi muscle. Expressed in the intrinsic and extrinsic muscle mass of the tongue. At 15 dpc expressed in mesenchymal tissue surrounding the cartilaginous anlage of immature bones, and in the future joint spaces. As endochondral ossification progresses, and the hypertrophic cartilage zone is replaced by mineralized bone, expression appears in the mineralizing portion of the bone. Expressed in mesoderm derived bones of the skull base and neural crest-derived endochondral bones such as the proximal mandible. {ECO:0000269|PubMed:10359609, ECO:0000269|PubMed:9832452}.
Protein families：