R4RL2_MOUSE Q7M6Z0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7M6Z0
Recommended name：Reticulon-4 receptor-like 2
EC number：
Alternative names：(Nogo receptor-like 3) (Nogo-66 receptor homolog 1) (Nogo-66 receptor-related protein 2) (NgR2)
Cleaved into：
GeneID：269295
Gene names (primary )：Rtn4rl2
Gene names (synonym )：Ngrl3
Gene names (ORF )：
Length：420
Mass：46075
Sequence：MLPGLRRLLQGPASACLLLTLLALPSVTPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIHPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALRDSDFQACPPPTPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPADSRGPALSAGLRTPLLCLLPLALHHL
Tissue specificity：Detected in brain (PubMed:22406547). Detected in hippocampus neurons (at protein level) (PubMed:22325200). {ECO:0000269|PubMed:22325200, ECO:0000269|PubMed:22406547}.
Induction：
Developmental stage：At 13.5 dpc, strongly expressed in PNS ganglia and developing heart, and weakly expressed in brain and spinal cord. By postnatal day 1, strongly expressed in dorsal root ganglia and in dorsal and gray matter areas of spinal cord. Expressed in various adult brain structures including the amygdala, cerebral cortex, cerebellum, hippocampus and olfactory bulb. {ECO:0000269|PubMed:14664809}.
Protein families：Nogo receptor family