R4RL1_MOUSE Q8K0S5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K0S5
Recommended name：Reticulon-4 receptor-like 1
EC number：
Alternative names：(Nogo receptor-like 2) (Nogo-66 receptor homolog 2) (Nogo-66 receptor-related protein 3) (NgR3)
Cleaved into：
GeneID：237847
Gene names (primary )：Rtn4rl1
Gene names (synonym )：Ngrl2
Gene names (ORF )：
Length：445
Mass：49836
Sequence：MLRKGCCVELLLLLLAGELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIYSNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLLHENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVPCATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRAARKEHHPSHGASRDKGHPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSGTALGAPLLAWILGLAVTLR
Tissue specificity：Detected in brain (at protein level) (PubMed:22406547). Detected in retina ganglion cell layer and inner nuclear layer (PubMed:22406547). {ECO:0000269|PubMed:22406547}.
Induction：
Developmental stage：At 13.5 dpc, strongly expressed in PNS ganglia and developing heart, and weakly expressed in brain and spinal cord. By postnatal day 1, strongly expressed in dorsal root ganglia and in dorsal and gray matter areas of spinal cord. Expressed in various adult brain structures including the amygdala, caudate putamen, cerebellum, cerebral cortex, hippocampus, olfactory bulb and thalamus. {ECO:0000269|PubMed:14664809}.
Protein families：Nogo receptor family