ZN185_MOUSE Q62394
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62394
Recommended name：Zinc finger protein 185
EC number：
Alternative names：(LIM domain protein Zfp185) (P1-A)
Cleaved into：
GeneID：22673
Gene names (primary )：Znf185
Gene names (synonym )：Zfp185
Gene names (ORF )：
Length：352
Mass：38322
Sequence：MTTEDYKKLAPYNIRRSSISGTEEEEVPFTPDEQKRRSQAALGVLRKTAPREHSYVLSAAKKTTSSPTQELQSPFLAKRVDVVDEDVLPEKNQEPPALARPDSGLSSSTTEKIAHRQITPPTAELHLVAPDLEALSTPDSCEENNAAPKIIKEIPGTLQDGQSDPTVASQQLADLSILEPLGSPSGAEQQIKAEDCTNMLMSPSSCMVTVTVSDTSEQSQLCVPGVSSKVDSSSTIKGILFVKEYMNTSEVSSGKPVSSHCDSPSSIEDSLDLAKKPPHEGTPSERPTEGVCTYCSHEIQDCPKITLEHLGICCHEYCFKCGICNKPMGDLLDQIFIHRDTIHCGKCYEKLF
Tissue specificity：Expressed in skin, kidney, ovary, testis. Also expressed in brain, cartilage, heart, lung, spleen and thymus.
Induction：
Developmental stage：At 14.5 dpc, only expressed in mesenchymal cells. At 16.5 dpc expressed also in cells lining the vertebrae and tendons of the proximal tail. In late embryogenesis, expressed in mesenchymal cells adjacent to the distal limb bones (tibia and calcaneum), in tendons and in the connective tissue sheath (epimysium) surrounding the skeletal muscle. Also expressed in the epithelia of the epididymis of the testis.
Protein families：