BOK_MOUSE O35425
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35425
Recommended name：Bcl-2-related ovarian killer protein
EC number：
Alternative names：(Apoptosis activator Mtd) (Protein matador)
Cleaved into：
GeneID：51800
Gene names (primary )：Bok
Gene names (synonym )：Mtd
Gene names (ORF )：
Length：213
Mass：23456
Sequence：MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERASPAPGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFLKAAFFLLLPER
Tissue specificity：Widely expressed (PubMed:9535847, PubMed:23429263). Highly expressed in brain, kidney, and spleen (PubMed:27098698). {ECO:0000269|PubMed:23429263, ECO:0000269|PubMed:27098698, ECO:0000269|PubMed:9535847}.
Induction：Induced upon proteasome inhibition. {ECO:0000269|PubMed:26949185}.
Developmental stage：At 15.0 dpc, expressed in brain, liver, thymus, lung, intestinal epithelium and follicles of the whiskers. {ECO:0000269|PubMed:9535847}.
Protein families：Bcl-2 family