VITRN_MOUSE   Q8VHI5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VHI5

Recommended name:Vitrin

EC number:

Alternative names:(Akhirin)

Cleaved into:

GeneID:74199

Gene names  (primary ):Vit

Gene names  (synonym ):Akh

Gene names  (ORF ):

Length:650

Mass:70699

Sequence:MGIVVPTMKASVIEVLLVLLVTGIHSNKETPKKTKRPKLTVPQINCDVKAGKIINPEFMVKCPAGCQDPKYHVYGTGVYASYSSVCGAAIHSGVLDNSGGKILVRKVAGQSGYKGSYSNGVQSLSLPRWRESFIVAESKPQKGVAYPSTLTYSSSKTAAAKAGETTKAYEKPSIPGTTIQPVTLTQAQATPVAEVTHRSTSKPFAASVTNSPRPQPVGHRSQEMEEVDGWKPGPVLLDSGFVPKEELSTQSSEPVPQGDPNCKIDLSFLIDGSTSIGKRRFRIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFASKAVCRTNGFYSFNVQSWLSLHKTVQPLVKRVCDTDRLACSKTCLNSADIGFVIDGSSSMGTSNFRTVLQFVANLSKEFEISDTDTRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLFKKSKPNKRKVMIIITDGRSYDDVRIPAMAAYQKGVITYAIGIAWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTEFNSQPRN

Tissue specificity:

Induction:Highly up-regulated in the injured spinal cord. {ECO:0000269|PubMed:25331329}.

Developmental stage:At 16.5 dpc, present in skull base cartilage (at protein level) (PubMed:18757743). Expressed in the floor plate as early as 9.5 dpc and shifted to the central canal area from 13.5 dpc. At 15.5 dpc, the expression is restricted to the ventral midline region (PubMed:25331329). {ECO:0000269|PubMed:18757743, ECO:0000269|PubMed:25331329}.

Protein families:


   💬 WhatsApp