NDNF_MOUSE Q8C119
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C119
Recommended name：Protein NDNF
EC number：
Alternative names：(Epidermacan) (Neuron-derived neurotrophic factor)
Cleaved into：
GeneID：68169
Gene names (primary )：Ndnf
Gene names (synonym )：
Gene names (ORF )：
Length：568
Mass：65027
Sequence：MELFYWCLLCLLLPLTSRTQKLPTRDEELFQMQIRDKEFFHDSSVIPDGAEVSSYLFRDTPRRYFFMVEEDNTPLSVTVTPCDAPLEWKLSLQELHEGSSADGSGDPELLDQQKQQMTDVEGTELFSYKGNDVEYFLSSSSPSGLYQLELLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSFGRTTVTLAWKPSPTASILKQPIEYCVVINKEHNFKSLCAAETKMNADDAFMVAPKPGLDFNPFDFAHFGFPTDNLGKDRSLLAKPSPKVGRHVYWRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFMVNTNTNMSTAYVGAFVRTKEEAKQKTVELKDGRVTDVFVKRKGKKFLRFAPVSSHQKVTFFIHSCMDAVQVQVRRDGRLLLSQNVEGIRQFQLRGKPKGKYLIRLKGNRKGASKLKILATTRPSKHAFPSLPEDTRIKAFDKLRTCSSVTVAWLGTQERRKFCIYRKEVDGNYSEDQKRREQNQCLGPDTRKKSEKVLCKYFHSQNLQKAVTTETIRDLQPGKSYLLDVYVVGHGGHSVKYQSKIVKTRKVC
Tissue specificity：Expressed in brain and spinal cord with no expression detected in heart, kidney or liver. Expressed by neurons but not by astrocytes. In the brain, detected in the cerebrum, cerebellum and olfactory bulbs. In the cerebral cortex, highly expressed in Cajal-Retzius cells. Also expressed in hippocampal neurons and in Purkinje and granule cells of the cerebellum (at protein level). {ECO:0000269|PubMed:20969804}.
Induction：Up-regulated in endothelial cells of muscles after hind limb ischemic surgery. {ECO:0000269|PubMed:24706764}.
Developmental stage：At 16.5 dpc, specifically expressed in the interfollicular basal cells of the epidermis (at protein level). Detected in the marginal cells and cortical plate of the brain cortex from 16 dpc to P90 with high levels between 16 dpc and P0 and lower levels from P7 to adulthood (at protein level). {ECO:0000269|PubMed:18757743, ECO:0000269|PubMed:20969804}.
Protein families：