TCF15_MOUSE Q60756
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60756
Recommended name：Transcription factor 15
EC number：
Alternative names：(TCF-15) (Meso1) (Paraxis) (Protein bHLH-EC2)
Cleaved into：
GeneID：21407
Gene names (primary )：Tcf15
Gene names (synonym )：Bhlhec2
Gene names (ORF )：
Length：195
Mass：20721
Sequence：MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEAARRGPGPGSGRRASNGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAAGGGKSAVPAADGRQPRSICTFCLSNQRKGGSRRDLGGSCLKVRGVAPLRGPRR
Tissue specificity：Expressed in heart and skeletal muscle.
Induction：
Developmental stage：At 7.5 dpc, low expression is detected in a subdomain of the primitive mesoderm. At 8.5 dpc, expressed at high levels throughout the uncompartmentalized epithelial somites and in the rostral paraxial mesoderm. By 9.5 dpc, expression is confined to the somite and is most prominent in the myotome and dermatome. At 10 dpc, expression in somite declines in the myotome but persists at high level in the dermatome. At 10.5 dpc, expression is seen only in the somites in the caudal portion of the embryo.
Protein families：